DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and try-8

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_504916.1 Gene:try-8 / 179134 WormBaseID:WBGene00017791 Length:401 Species:Caenorhabditis elegans


Alignment Length:293 Identity:52/293 - (17%)
Similarity:100/293 - (34%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVH----TKDMQG-----RITNGYPAEEGKAPYTVG 56
            :....:::|..:.::|.....:|:.|:...:.    ||..:.     ::.||..|..|:.|:||.
 Worm     2 VSCLFSLVAFIILASSSVDAFKLSEEENAALQKTCGTKMREADSYTRKVLNGTIANAGETPWTVA 66

  Fly    57 L----GFSGGWWCGGSIIAHDWVLTAE-------------------------HCIGD-----ADS 87
            |    ......:..|:::::..:::.:                         .|.|:     :|.
 Worm    67 LYIPDHLDHSVYTTGTLVSNRHIISYDRLFLTNTTDGIKLRHNLKAVIEKDMECEGNDYLLPSDL 131

  Fly    88 VTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPH---VDF-WHMVNKVEL-----PSYND 143
            |        |:.|.|...:.......|...|:..:||.:   ..| ::.|..:||     ...|.
 Worm   132 V--------RSVAVFLDLLSVERQSGHEQLDVKSVRILNGCVKSFQFNRVAVIELKKPVHKGQNA 188

  Fly   144 R----------YNDYNEWWAVACGWG---GTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNI 195
            |          |..|..:     |:|   |....:.| .:.:..::...|.||          ::
 Worm   189 RPICFGSDFRIYTGYKFF-----GYGDNRGAVKDATL-RHTKIKEVPCKHPSE----------DL 237

  Fly   196 LCVRTPDGKSTCGGDSGGPLVT--HDGTKLVGV 226
            .||...:  ..|.||.||..|:  |...:..||
 Worm   238 FCVTAEN--PLCNGDFGGAAVSKFHGSVRAYGV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 46/246 (19%)
Tryp_SPc 40..256 CDD:238113 46/245 (19%)
try-8NP_504916.1 DUF316 11..304 CDD:367641 51/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.