DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tpsb2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:280 Identity:89/280 - (31%)
Similarity:127/280 - (45%) Gaps:54/280 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW---CG 66
            :::||..|.||     ||.|.:::          .|..|:.|.|.|.|:.|.|.|...:|   ||
Mouse    12 LSLLASLVYSA-----PRPANQRV----------GIVGGHEASESKWPWQVSLRFKLNYWIHFCG 61

  Fly    67 GSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHW----VGNGNFIKH-------SSADIA 120
            ||:|...|||||.||:|........|....|  .|:.::    :.....:.|       ..||:|
Mouse    62 GSLIHPQWVLTAAHCVGPHIKSPQLFRVQLR--EQYLYYGDQLLSLNRIVVHPHYYTAEGGADVA 124

  Fly   121 L--IRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPL-PDY-LQCVDLQIIHN 181
            |  :.:| |:....::.:.||..::.:......|..  |||...:..|| |.| |:.|.:.|:.|
Mouse   125 LLELEVP-VNVSTHLHPISLPPASETFPPGTSCWVT--GWGDIDNDEPLPPPYPLKQVKVPIVEN 186

  Fly   182 SECSGYYGS----------VGDNILCVRTPDGKSTCGGDSGGPLVTH-DGTKL-VGVTNFGSVAG 234
            |.|...|.:          |.|.:||... ..:.:|.||||||||.. .||.| .||.::|.  |
Mouse   187 SLCDRKYHTGLYTGDDFPIVHDGMLCAGN-TRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGE--G 248

  Fly   235 C-QSGAPAGFQRVTYHLDWI 253
            | |...|..:.||||:||||
Mouse   249 CAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 79/244 (32%)
Tryp_SPc 40..256 CDD:238113 81/245 (33%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.