DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Gzmb

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_612526.2 Gene:Gzmb / 171528 RGDID:620018 Length:248 Species:Rattus norvegicus


Alignment Length:277 Identity:76/277 - (27%)
Similarity:113/277 - (40%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGL----GFSG 61
            ||..:.:|:.::|..:.|                   |.|..|:.|:....||...|    .:||
  Rat     1 MKLLLLLLSFSLAPKTEA-------------------GEIIGGHEAKPHSRPYMAYLQIMDEYSG 46

  Fly    62 GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA-TWRTNAQFTHWVGNGNFIKHS-------SAD 118
            ...|||.:|..|:||||.||.|...:||:  || ..:...:....:.....|.|.       |.|
  Rat    47 SKKCGGFLIREDFVLTAAHCSGSKINVTL--GAHNIKEQEKMQQIIPVVKIIPHPAYNSKTISND 109

  Fly   119 IALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG-----GTYDGSPLPDYLQCVDLQ 177
            |.|::: ........|..:.||..|.:....:..:  ..|||     |.|.     |.||.|:|.
  Rat   110 IMLLKLKSKAKRSSAVKPLNLPRRNVKVKPGDVCY--VAGWGKLGPMGKYS-----DTLQEVELT 167

  Fly   178 IIHNSECSGYYGSVGD--NILCVRTPDGK-STCGGDSGGPLVTHDGTKLV--GVTNFGSVAGCQS 237
            :..:.:|..|..:..|  |.:|...|..| ::..||||||||    .|.|  |:.::|...|   
  Rat   168 VQEDQKCESYLKNYFDKANEICAGDPKIKRASFRGDSGGPLV----CKKVAAGIVSYGQNDG--- 225

  Fly   238 GAPAGFQRVTYHLDWIR 254
            ..|..|.:|:..|.||:
  Rat   226 STPRAFTKVSTFLSWIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/236 (29%)
Tryp_SPc 40..256 CDD:238113 70/238 (29%)
GzmbNP_612526.2 Tryp_SPc 20..241 CDD:214473 68/236 (29%)
Tryp_SPc 21..244 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.