DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CTRL

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:251 Identity:78/251 - (31%)
Similarity:119/251 - (47%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGW-WCGGSIIAHDWVLTAEHC----------IGDADSVTVYF 92
            ||.||..|..|..|:.|.|..|.|: :||||:|:..||:||.||          :|:.|.     
Human    33 RIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDR----- 92

  Fly    93 GATWRTNAQFTHWVGNGNFIKHSS-------ADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYN 149
                .:||:....:.....|.|.|       .|:.|:::.. ..:...::.|.|.|.|:...:  
Human    93 ----SSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTE-- 151

  Fly   150 EWWAVAC---GWG---GTYDGSPLPDYLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGKSTC 207
               .:.|   |||   |.  |:..|.:||.|.|.::..::|..|:| |:.|:::|.... |.|:|
Human   152 ---GLTCVTTGWGRLSGV--GNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGA-GASSC 210

  Fly   208 GGDSGGPLVTHDGTK--LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
            .||||||||...|..  |:|:.::|: ..|...|||.:.||:....||  :..|||
Human   211 QGDSGGPLVCQKGNTWVLIGIVSWGT-KNCNVRAPAVYTRVSKFSTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/241 (30%)
Tryp_SPc 40..256 CDD:238113 74/243 (30%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 74/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.