DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG43742

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:241 Identity:74/241 - (30%)
Similarity:111/241 - (46%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA--------- 94
            |:.||:.|...:  :...|..:..::||||:|...:||||.||:.|.|.|||:.|.         
  Fly    34 RVANGHTAITSQ--FMAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPV 96

  Fly    95 ---TWRTNAQ-FTHWVGNGNFIKHSSADIALIRI-------PHVDFWHMVNKVELPSYNDRYNDY 148
               ..|.||: ..|...:||...:   ||||:|:       .|:....::...::.|.|.  |::
  Fly    97 CKHVLRLNAKVILHPNFHGNIFLN---DIALLRLEREVIFEAHIRPICIILDEDVTSNNQ--NNF 156

  Fly   149 NEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGG 213
                 .|.|||.|..|: :.|.|..:||..:..|.|   |.::  |.:|..:..| .||..||||
  Fly   157 -----TAYGWGKTEHGN-ISDVLSFIDLVRLPKSMC---YQNI--NTICAGSTSG-DTCESDSGG 209

  Fly   214 PLV---THDGTK---LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ||:   .|.|..   |.|:|::|. |.| ||....:..|..:..||
  Fly   210 PLIGNFVHRGKSRDILFGITSYGD-AEC-SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/239 (30%)
Tryp_SPc 40..256 CDD:238113 73/240 (30%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 72/239 (30%)
Tryp_SPc 35..256 CDD:238113 73/240 (30%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435748
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.