DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP001365

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_321778.5 Gene:AgaP_AGAP001365 / 1281817 VectorBaseID:AGAP001365 Length:608 Species:Anopheles gambiae


Alignment Length:267 Identity:73/267 - (27%)
Similarity:117/267 - (43%) Gaps:55/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG--------D 84
            |.||.|: ::.||..|..:.:|:.|:.|.:.....:.||||||...|:|||.||:.        |
Mosquito   353 LEPVGTR-IRSRIIGGVTSNQGEHPWHVAIYLDEEYQCGGSIIGRRWILTAAHCLTRQNTNETLD 416

  Fly    85 ADSVTVYFGAT---------WRTNAQFTHWVGNGNFIKHS-------SADIALIRIP-HVDFWHM 132
            .|...||.|..         :||..:         .|.|.       :.||.|:|:. ::.:...
Mosquito   417 VDLFRVYTGIIDISTIDDHFYRTADE---------VIVHRDYNPVMYTTDIGLLRLKRNITYNSF 472

  Fly   133 VNKVELPSYNDRYNDYNEWW---AVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS----GYYG- 189
            :..|.|  || |..|.:.::   ....|||...|| .:.:.|..:::.::....||    .:.| 
Mosquito   473 IKPVCL--YN-RTVDISTFYGREGKVTGWGFNRDG-VISNVLNYLEVPVVSQKMCSQRNVQFNGV 533

  Fly   190 -SVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVTNFG----SVAGCQSGAPAGFQRVT 247
             :||:: .|....||.|.|.|||||.||..:|.:  :.|:.:..    ::..|.....:.|..|:
Mosquito   534 LAVGES-FCAGHADGNSVCNGDSGGGLVFAEGPRYYVRGIVSISAQRRNLLLCDPNQYSVFTDVS 597

  Fly   248 YHLDWIR 254
            ..|:|||
Mosquito   598 KFLNWIR 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/253 (26%)
Tryp_SPc 40..256 CDD:238113 68/255 (27%)
AgaP_AGAP001365XP_321778.5 GD_N 42..144 CDD:292649
GD_N 190..297 CDD:292649
Tryp_SPc 363..603 CDD:214473 66/253 (26%)
Tryp_SPc 364..606 CDD:238113 68/255 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.