DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CLIPA5

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:289 Identity:74/289 - (25%)
Similarity:110/289 - (38%) Gaps:64/289 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GATMPRLATEKLTP---VHTKDMQGRITNGYPAEE---GKAPYTVGLGFSGG----------WWC 65
            |...|...||::.|   |..|:..|....|....|   |:.|:.|.:..|..          :.|
Mosquito   101 GVIKPSGRTEQVRPTCGVRNKNGLGFSVTGVKDGESHYGEFPWMVAVMLSSPMDNSDSILNVYQC 165

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGA-TWRT----------NAQFTHWVGNGNFIKHSSA-D 118
            |||:||.:.||||.||:.:.....:...| .|.|          |.:....:.:..|...|.| |
Mosquito   166 GGSVIAPNVVLTAAHCVFNKPKTQLLLRAGEWDTQTEHELYMHQNRRVAEVILHEAFDNESLAND 230

  Fly   119 IALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWG-------GTYDGSPLPDYLQCVD 175
            :||:.:.. ......|..:.||.....: ||..  ..|.|||       |.|.     ..|:.|:
Mosquito   231 VALLTLAEPFQLGENVQPICLPPSGTSF-DYQH--CFASGWGKDQFGKEGKYQ-----VILKKVE 287

  Fly   176 LQIIHNSECS--------GYYGSVGDNILCVRTPDGKSTCGGDSGGPLV-------THDGTKLVG 225
            |.::.:::|.        |.:..:..:.||.....|:..|.||.|.|||       ||  ....|
Mosquito   288 LPVVPHAKCQETMRSQRVGNWFVLDQSFLCAGGVAGQDMCRGDGGSPLVCPIPGSPTH--YYQAG 350

  Fly   226 VTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            :..:|  .|| :.|.|..:..|.:..|||
Mosquito   351 IVAWG--LGCGEDGIPGVYGDVAFLRDWI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 64/262 (24%)
Tryp_SPc 40..256 CDD:238113 66/263 (25%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 65/255 (25%)
Tryp_SPc 135..377 CDD:214473 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.