DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:150 Identity:37/150 - (24%)
Similarity:60/150 - (40%) Gaps:24/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 VNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP--LPDYLQCVDLQIIHNSECS--------GY 187
            ||.:.||..:..::...   .||.|||....|:.  |...::.|:|.::....|.        |.
Mosquito     4 VNTICLPPADYIFDPVR---CVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGR 65

  Fly   188 YGSVGDNILCVRTPDGKSTCGGDSGGPLV-----THDGTKLVGVTNFGSVAGCQSGAPAGFQRVT 247
            ...:.::.:|.....|:.||.||.|.|||     ..:|....|:..:|...| :.|.|..:..|.
Mosquito    66 QFKLHESFVCAGGEKGRDTCKGDGGSPLVCPIPGVANGYYQAGIVAWGIDCG-KEGIPGVYVNVA 129

  Fly   248 YHLDWI-----RDHTGIAYY 262
            ...:||     :.:..|.||
Mosquito   130 LFREWIDEQLRKRNLAIDYY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 32/134 (24%)
Tryp_SPc 40..256 CDD:238113 34/142 (24%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 34/137 (25%)
Tryp_SPc <2..135 CDD:214473 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.