DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:271 Identity:75/271 - (27%)
Similarity:110/271 - (40%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGL--GFSGGWWCGGSIIAHDWVLTAEHCI----GDADSVTVYF------ 92
            |..|.||.....|:...|  ..|....||||:|:...:|||.||:    .|.|. .::|      
Mosquito     9 IAYGQPARAYAFPWMALLETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDD-RIHFKDDEYD 72

  Fly    93 --------GATWRTN----AQ-------FTHWVGNGNFIKHSSA----DIALIRI--PHVDFWHM 132
                    ||.:..:    ||       .||       .|:|:.    |:|:||:  |.:..:::
Mosquito    73 SGESEEADGAEYSASCGPPAQRIPIETIVTH-------PKYSARSKRNDLAIIRLQYPAIIGYNV 130

  Fly   133 VNKVELPSYNDRYNDYNEWWAVACGWGGTYDGS-------------PLPD---YLQCVDLQIIHN 181
            : .:.|| ..::...|....:...|||.|..|.             ||||   .::.:|..|:  
Mosquito   131 I-PICLP-LTEQLRAYRPADSFVTGWGLTETGQRSAVLRYAILPALPLPDCAMRIKELDRIIV-- 191

  Fly   182 SECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPL-VTHDGTKLV--GVTNFGSVAGCQSG-APAG 242
                     :.|..||....:..:.|.||||||| ...|.|:.|  ||.:|| |..|.:. ||..
Mosquito   192 ---------LDDGHLCAGGNNRTAHCHGDSGGPLQYVSDSTRFVLQGVVSFG-VKTCGTKIAPGV 246

  Fly   243 FQRVTYHLDWI 253
            |..||:.:|||
Mosquito   247 FANVTHFIDWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/269 (27%)
Tryp_SPc 40..256 CDD:238113 75/271 (28%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 73/269 (27%)
Tryp_SPc 9..257 CDD:238113 73/269 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.