DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG43335

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:286 Identity:74/286 - (25%)
Similarity:122/286 - (42%) Gaps:53/286 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILA----LAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW 63
            ||:.|::    |.....|....|......:...|    :.||..|..||....|:...|.....:
  Fly     5 AFLVIISVCQWLCRFGESRLLEPNCGIRTMPSFH----RTRIIGGSDAEITSHPWMAYLYNEFHY 65

  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNF-------------IKHS 115
            :|.|::|.:.:||||.|||..:.::||..|.:..|.:       :|:.             |||.
  Fly    66 FCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRS-------DGSMCQITAEDYSVSMAIKHK 123

  Fly   116 -------SADIALIRIPH-VDFWHMVNKVEL---PSYNDRYNDYNEWWAVACGWGGTYDGSPLPD 169
                   ..|||:||:.. |.|:..:..:.:   |:......|  ....:|.|| |..|....|.
  Fly   124 YFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLED--GMTLMATGW-GLADKRMHPH 185

  Fly   170 YLQCVDLQIIHNSECSGYYG-SVGDNILCVRTPDGKSTCGGDSGGPL---VTHDG-TKLV--GVT 227
            .||...:.:::.:.||..|. ::....:|....: .:||.|||||||   |.:.| .:.|  |:|
  Fly   186 LLQEAPITVMNRNVCSKLYDVAITQGQICAGDKE-TNTCLGDSGGPLGGVVNYYGDLRFVQYGIT 249

  Fly   228 NFGSVAGCQSGAPAGFQRVTYHLDWI 253
            :||.:. |:|  |:.:..::.:..||
  Fly   250 SFGDIE-CRS--PSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/244 (27%)
Tryp_SPc 40..256 CDD:238113 66/245 (27%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 65/244 (27%)
Tryp_SPc 42..275 CDD:238113 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.