DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG43110

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:223 Identity:64/223 - (28%)
Similarity:98/223 - (43%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG 93
            |||      .:|.:|..|.:..|.|..|:..:....|||:||..|:|||..|| ....::.|..|
  Fly    31 TPV------PKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC-KSTQTLFVRLG 88

  Fly    94 ATWRTN-----AQFTHWVGNGNFIKHSSA-DIALIRIPHVDFWHMVNKVELPSYND-------RY 145
            | :..|     .:....:.:..:...:.| ||||:::.....::: |...:..:.|       ||
  Fly    89 A-YNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNL-NIQPICIHLDATLGKQIRY 151

  Fly   146 NDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGD-NILCVRTPDGKSTCGG 209
              ||     |.|||.|.:... .|.||.:.:...:...|..|.|...| ..:|..|..| .||.|
  Fly   152 --YN-----AFGWGRTRNAEQ-SDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQG-DTCAG 207

  Fly   210 DSGGPL---VTHDGTKL---VGVTNFGS 231
            ||||||   :|:.|...   .|:|::|:
  Fly   208 DSGGPLISKITYQGKNFDTQFGITSYGT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/213 (29%)
Tryp_SPc 40..256 CDD:238113 61/212 (29%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 61/213 (29%)
Tryp_SPc 36..257 CDD:238113 61/212 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.