DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG43125

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:87 Identity:22/87 - (25%)
Similarity:39/87 - (44%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APYTVGL--GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG---ATWRTNAQFTH---WVG 107
            ||:.|.:  ..|....|.|::|...:||||..||.....:.|..|   .|.:.:::..:   :|.
  Fly    36 APWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVA 100

  Fly   108 NGNFIKHSSAD-----IALIRI 124
            .....:..|::     |||:|:
  Fly   101 RALIHRSYSSESHQYNIALLRL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 22/87 (25%)
Tryp_SPc 40..256 CDD:238113 22/87 (25%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.