DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG43125

DIOPT Version :10

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:87 Identity:22/87 - (25%)
Similarity:39/87 - (44%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 APYTVGL--GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG---ATWRTNAQFTH---WVG 107
            ||:.|.:  ..|....|.|::|...:||||..||.....:.|..|   .|.:.:::..:   :|.
  Fly    36 APWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVA 100

  Fly   108 NGNFIKHSSAD-----IALIRI 124
            .....:..|::     |||:|:
  Fly   101 RALIHRSYSSESHQYNIALLRL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 40..256 CDD:238113 22/87 (25%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:473915 21/86 (24%)

Return to query results.
Submit another query.