DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP009966

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_319102.4 Gene:AgaP_AGAP009966 / 1279386 VectorBaseID:AGAP009966 Length:288 Species:Anopheles gambiae


Alignment Length:249 Identity:72/249 - (28%)
Similarity:118/249 - (47%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIG--DADSVTVYFGATWRTNAQ 101
            ||..|.|.:....||.|.|. .|..:||.|||...|:|||.||..  :|.::.::.|:       
Mosquito    45 RIVGGVPVDIRDYPYQVSLR-RGRHFCGESIIDSQWILTAAHCTRTINARNLWIHVGS------- 101

  Fly   102 FTHWVGNGNFIK------H------SSADIALIRIPH-VDFWHMVNKVEL--PSYNDRYNDYNEW 151
             :|....|..::      |      |..|.:|:.:.. ::....|..:.|  ||.::...:.:: 
Mosquito   102 -SHVNDGGESVRVRRILHHPKQNSWSDYDFSLLHLDQPLNLSESVQPIPLRKPSASEPTGELSD- 164

  Fly   152 WAVAC---GWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY---GSVGDNILCVRTPD-GKSTCGG 209
             ...|   |||.|::.......|:...:.:.::.:||..|   |||.::::|....: ||.:|.|
Mosquito   165 -GTLCKVSGWGNTHNPDESALVLRAATVPLTNHQQCSEVYEGIGSVTESMICAGYDEGGKDSCQG 228

  Fly   210 DSGGPLVTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWIRD--HTGIA 260
            |||||||. || :|.||.::|.  || :.|.|..:.:|:...:||..  ||.:|
Mosquito   229 DSGGPLVC-DG-QLTGVVSWGK--GCAEPGYPGVYAKVSTAYEWIEQTVHTALA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 67/238 (28%)
Tryp_SPc 40..256 CDD:238113 68/242 (28%)
AgaP_AGAP009966XP_319102.4 Tryp_SPc 45..269 CDD:214473 67/238 (28%)
Tryp_SPc 46..272 CDD:238113 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.