DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP003960

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_318412.5 Gene:AgaP_AGAP003960 / 1278781 VectorBaseID:AGAP003960 Length:579 Species:Anopheles gambiae


Alignment Length:270 Identity:61/270 - (22%)
Similarity:97/270 - (35%) Gaps:77/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGF----SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNA 100
            ||||..::||..|:.|.|..    |..:.|||||:..:.:|||.||:                  
Mosquito    39 ITNGLESKEGDWPWHVALFHNNRRSFEYACGGSILDQNTILTAAHCL------------------ 85

  Fly   101 QFTHWVGNGNFIK-----------------HS-------------------SADIALIRI-PHVD 128
                |:.||...|                 |:                   :.|||||:: ..:.
Mosquito    86 ----WLSNGLIAKERLLVQVGRSRLRVASIHARDHEAYELIVHPKYNVNQIANDIALIKLATDIT 146

  Fly   129 FWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLP-DYLQCVDLQIIHNSEC-----SGY 187
            |.:.|..:.|.:..|..:..........|:|  ||.:..| |.|:...|.::...:|     ..:
Mosquito   147 FTNFVQPICLWNRGDDQSSIVGTLGTVIGFG--YDETDNPTDTLREARLPVVSAIDCIQSNREAF 209

  Fly   188 YGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGT--KLVGVTNF----GSVAGCQSGAPAGFQRV 246
            ...:..::.|....:|.|.|.|||||.|..:...  .:.|:.:|    .....|.:.....|..|
Mosquito   210 ATQLTSDMFCAGYRNGTSPCNGDSGGGLFFNFNNVWYIRGLVSFTKPRQDTTICDTKEYTVFTDV 274

  Fly   247 TYHLDWIRDH 256
            ..:|.||..:
Mosquito   275 AKYLRWIEQY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 59/265 (22%)
Tryp_SPc 40..256 CDD:238113 61/268 (23%)
AgaP_AGAP003960XP_318412.5 Tryp_SPc 39..283 CDD:238113 61/267 (23%)
Tryp_SPc 39..281 CDD:214473 59/265 (22%)
Tryp_SPc 331..573 CDD:214473
Tryp_SPc 331..573 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.