DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP004770

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_318046.3 Gene:AgaP_AGAP004770 / 1278456 VectorBaseID:AGAP004770 Length:259 Species:Anopheles gambiae


Alignment Length:269 Identity:71/269 - (26%)
Similarity:116/269 - (43%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVH-TKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW 64
            |...:||:.:  .|.|....|        ||. ..:...||..|:..:.|.||:...:...|...
Mosquito     1 MNELLAIMCM--LSCSSVLEP--------PVSILNETTQRIVGGHEIDIGAAPFQASVQSHGVHV 55

  Fly    65 CGGSIIAHDWVLTAEHCIG-DADSVTVYFGATWRTNAQFTHWVGNGNFIKHS--------SADIA 120
            ||||||...|||:|.||.. :.:|::|...:....  |....|.....|:|.        ..|::
Mosquito    56 CGGSIIHQQWVLSAGHCSSKEPNSLSVRVASIHHN--QGGQIVNVEESIRHPLYDEQLIIDYDVS 118

  Fly   121 LIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC 184
            |:|:.. :.|...|..:.||..::.:.|...  .|..|||.|.:.....|.|:..|:.:::::.|
Mosquito   119 LLRLEQCLTFSPNVQAIRLPMQDEFFQDGTV--CVVSGWGATQNPVESSDRLRATDVPLVNHAVC 181

  Fly   185 SGYY----GSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQ 244
            ...|    .::.|.::|. ....|:..|.|||||||. ::.| |:||.::.:....:...|..:.
Mosquito   182 QTAYISAAATITDRMICAGYFSGGRDACQGDSGGPLY-YENT-LIGVVSWRTGDCAEVNFPGVYS 244

  Fly   245 RVTYHLDWI 253
            ||.....||
Mosquito   245 RVASVRAWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 61/228 (27%)
Tryp_SPc 40..256 CDD:238113 62/229 (27%)
AgaP_AGAP004770XP_318046.3 Tryp_SPc 30..253 CDD:214473 61/228 (27%)
Tryp_SPc 31..256 CDD:238113 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.