DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:281 Identity:75/281 - (26%)
Similarity:123/281 - (43%) Gaps:41/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDM--QGRITNGYPAEEGKAPYTVGLGFSGGW 63
            ||:.:|:...|::..|..|:.....::.:|:....:  ..|:..|........||.|.|......
Mosquito    11 MKSLVALCVCAMSLVSHHTVRSSPIKRTSPICKYGLINMARVVGGSDTTIEAHPYQVSLRRLHKH 75

  Fly    64 WCGGSIIAHDWVLTAEHCIGDADSVTVYF----GATWR-------------TNAQFTHWVGNGNF 111
            .|||:|:..:.:|||.||:...:.|...|    |:|:|             |:..:..|.     
Mosquito    76 SCGGAILNTNTILTAAHCVDYPELVPSDFEVRAGSTFRNEGGQLITVAQIHTHPSYNDWT----- 135

  Fly   112 IKHSSADIALIR-IPHVDFWHMVNKVELPSYNDRYNDYNEWWAVA-CGWGGTYDGSPLPDYLQCV 174
               ...||:::: :..:.....|..:.||   ||.....:..:|: .|||..|...|..::||.|
Mosquito   136 ---LEWDISVLKLVSSLQLSPTVQPISLP---DRGLTIPDGTSVSLAGWGSLYYQGPSTNHLQHV 194

  Fly   175 DLQIIHNSECSGYYGSVGDNI---LCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQ 236
            .|.|:.||.|...|.:....:   :|. ...||..|.||||||||..  :::||:.::|  .||.
Mosquito   195 MLPIVSNSRCGMAYKNFAPILPFHICA-GHKGKDACQGDSGGPLVYQ--SRVVGIVSWG--YGCA 254

  Fly   237 -SGAPAGFQRVTYHLDWIRDH 256
             ...|:.:.||:..||:|..|
Mosquito   255 FENYPSVYTRVSEFLDFIGQH 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/236 (28%)
Tryp_SPc 40..256 CDD:238113 66/238 (28%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 66/236 (28%)
Tryp_SPc 52..272 CDD:238113 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.