DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:285 Identity:87/285 - (30%)
Similarity:128/285 - (44%) Gaps:39/285 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAI-LALAVASASGATMPRLATEKLT-PV---HTKDMQG-RITNGYPAEEGKAPYTVGLGF 59
            :..|.|| ||:.:|..:.|........||| |.   :...:.| ||..|:..:...|||.:.|.:
Mosquito     2 LSKFTAILLAVHIALFACALTQAEKRHKLTRPAFHPNAPYLAGKRIVGGFVIDISDAPYQISLQY 66

  Fly    60 SGGWWCGGSIIAHDWVLTAEHCIGDADSV--TVYFGATWRTNAQFTHWVGNGNFIK--------- 113
            :|...|||||:...|:|||.|||.....|  ||..|::       .|..| |..:.         
Mosquito    67 NGKHHCGGSILNSKWILTAAHCIDLYSEVKPTVRVGSS-------EHAAG-GTVLHLLRIVPHPG 123

  Fly   114 HSSA----DIALIRIP-HVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQC 173
            |||.    ||||:.:. .:.|...|..|:||..:|..::..  ..:..|||.|...:.|...|:.
Mosquito   124 HSSGGNNYDIALLELECELTFNDNVQPVQLPEQDDPIDEGT--MGIVSGWGMTMSAADLNAILRA 186

  Fly   174 VDLQIIHNSECS-GY--YGSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAG 234
            .::..::..||: .|  ||.|.:.:.|. ....|..||..|||||.|...  ||:||.::.....
Mosquito   187 TNVPTVNQQECNQAYQSYGGVAEQMFCAGYKQGGTGTCRNDSGGPFVAEG--KLIGVVSWSHECA 249

  Fly   235 CQSGAPAGFQRVTYHLDWIRDHTGI 259
            . :|.|..:.||....||||:.:|:
Mosquito   250 L-AGYPGVYARVASVRDWIRETSGV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 71/233 (30%)
Tryp_SPc 40..256 CDD:238113 73/235 (31%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 71/233 (30%)
Tryp_SPc 47..270 CDD:238113 73/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.