DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and TRY1_ANOGA

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_317170.2 Gene:TRY1_ANOGA / 1277688 VectorBaseID:AGAP008296 Length:274 Species:Anopheles gambiae


Alignment Length:290 Identity:89/290 - (30%)
Similarity:130/290 - (44%) Gaps:55/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASA-----------SGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYT 54
            :...:|::|.|.|.|           |.:..||.|..:           ||..|:..:...|||.
Mosquito     9 LAVLVAVVACAEAQANQRHRLVRPSPSFSPRPRYAVGQ-----------RIVGGFEIDVSDAPYQ 62

  Fly    55 VGLGFSGGWWCGGSIIAHDWVLTAEHCIGDA--DSVTVYFGATWRTNAQFTHWVGN-----GNFI 112
            |.|.::....||||:::..|||||.||...|  .|:||..|.:       .|..|.     ...:
Mosquito    63 VSLQYNKRHNCGGSVLSSKWVLTAAHCTAGASPSSLTVRLGTS-------RHASGGTVVRVARVV 120

  Fly   113 KH----SSA---DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD 169
            :|    ||:   |.:|:.: ..:.|...|..|.||..::...|..  .....|||.|...:....
Mosquito   121 QHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGLPKQDETVKDGT--MTTVSGWGNTQSAAESNA 183

  Fly   170 YLQCVDLQIIHNSECSGYY---GSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFG 230
            .|:..::..::..||:..|   |.|.|.:||. ....||..|.||||||||. || |||||.::|
Mosquito   184 VLRAANVPTVNQKECNKAYSEFGGVTDRMLCAGYQQGGKDACQGDSGGPLVA-DG-KLVGVVSWG 246

  Fly   231 SVAGC-QSGAPAGFQRVTYHLDWIRDHTGI 259
              .|| |:|.|..:.||....||:|:::|:
Mosquito   247 --YGCAQAGYPGVYSRVAVVRDWVRENSGV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 77/233 (33%)
Tryp_SPc 40..256 CDD:238113 78/235 (33%)
TRY1_ANOGAXP_317170.2 Tryp_SPc 47..268 CDD:214473 77/233 (33%)
Tryp_SPc 48..271 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.