DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:301 Identity:87/301 - (28%)
Similarity:139/301 - (46%) Gaps:47/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATM-----PR----------------LATEKLTPVHTKDM--QGRITN 42
            ||.|..:.|.|:....|...     ||                .|.:.|.|: |.|.  ..||::
Mosquito     1 MKKFTVLAATALLLLLGQVSSTPVDPRSVDWSVVRTLHQTDAIRAKQGLAPL-TDDQVRSSRISD 64

  Fly    43 GYPAEEGKAPYTVGL---GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTH 104
            |..|...:.|:.||:   |.|...:|.|.:|:..:||||..||..::::|:..||:..|..:  .
Mosquito    65 GQIATATQFPWAVGVLISGSSSHSFCSGVLISPRFVLTAAVCISGSNTLTILLGASDMTRVE--E 127

  Fly   105 WVGNGNFIKH-------SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGT 161
            ::|..|.:.|       :..|||::.:.. ....:.:..::||.::|..|::|.|.|...|||.|
Mosquito   128 FIGVSNILSHPNYSSFFNRDDIAILTLSSPAPIRNTIRPIDLPRWSDVGNNFNNWAATTAGWGNT 192

  Fly   162 ----YDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPL-VTHDG- 220
                .:..|:|:....|| .:..|..|...:..:.|..:|..|.:| ..|.||.|||: ||..| 
Mosquito   193 GRRENEPIPIPNLHFAVD-SVNSNFVCGLSHTFIRDTHICTSTDNG-GPCNGDEGGPVTVTESGR 255

  Fly   221 TKLVGVTNF--GSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            |.|||:.:|  ..:.||..|..|...|:|.:|.||:|:|.:
Mosquito   256 TFLVGIHSFHYSGLFGCDRGRSAVHTRITEYLGWIQDNTDV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 70/232 (30%)
Tryp_SPc 40..256 CDD:238113 71/234 (30%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 70/232 (30%)
Tryp_SPc 62..293 CDD:238113 71/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.