DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005664

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315684.2 Gene:AgaP_AGAP005664 / 1276347 VectorBaseID:AGAP005664 Length:306 Species:Anopheles gambiae


Alignment Length:297 Identity:88/297 - (29%)
Similarity:130/297 - (43%) Gaps:54/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILAL-AVASASGATMPRLATEKLTPVHTKD-----------------MQGRITNGYPAE 47
            ||.|..::|| |.|:|.      :...|:.|:...|                 ...|:.||..|.
Mosquito    10 MKTFALLVALFAAANAD------IDWSKVRPIEEFDHYWARLPQELQIYRYAQPSHRVVNGQEAT 68

  Fly    48 EGKAPYTVGL---GFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQ-------- 101
            .|:.||.:.|   ...|...||||::.:::||||.||:....| ||..|......|.        
Mosquito    69 PGQFPYQIALLSNFLIGTGLCGGSVLTNNYVLTAAHCVIMGTS-TVALGGNAIMGAHNRDAPEPS 132

  Fly   102 -----FTHWVGNGNFIKHSSA----DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVAC 156
                 ||. .|......:|||    |||::|: ..:.|...:....||:.:|. ..:..:.....
Mosquito   133 QQIIAFTS-AGISAHPGYSSANIRNDIAVVRLNSPITFTDRIQPARLPARSDT-RQFGGFTGTVS 195

  Fly   157 GWGGTYDGS-PLPDYLQCVDLQIIHNSECSGYYGSV---GDNILCVRTPDGKSTCGGDSGGPLVT 217
            |:|.|.|.| .....:......::.|::|...:.:|   ..|: |:....|:|.|.|||||||..
Mosquito   196 GFGRTSDASQATSSVVMFTSNPVMTNADCIAQWNAVLIEPQNV-CMSGEGGRSACNGDSGGPLAV 259

  Fly   218 HDGTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            .||..| |||.:|||.|||..|.|:.:.||::.||:|
Mosquito   260 QDGGSLQVGVVSFGSAAGCAIGMPSVYARVSFFLDFI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/239 (32%)
Tryp_SPc 40..256 CDD:238113 76/240 (32%)
AgaP_AGAP005664XP_315684.2 Tryp_SPc 60..296 CDD:214473 76/239 (32%)
Tryp_SPc 61..299 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.