DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005594

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_315604.2 Gene:AgaP_AGAP005594 / 1276280 VectorBaseID:AGAP005594 Length:294 Species:Anopheles gambiae


Alignment Length:298 Identity:63/298 - (21%)
Similarity:102/298 - (34%) Gaps:62/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRIT----------------NGYPAEEGKA 51
            |.|....:.|......|...|...|:.|:..:..:|..|                .||.|..|:.
Mosquito     4 AAIVCFVIGVVGVFANTSAALDVIKVNPMSDETPEGFKTMSAGTVVPYTYSATYWYGYNAYAGQF 68

  Fly    52 PYTVGLGFSGGWWC---GGSIIAHDWVLTA----EHCIGDADSVTVY--FGATWRTNAQFTHWVG 107
            ||...:.|....:.   .|::|..::|:|.    .|.....|.:..|  .|:.:.:.   |.|..
Mosquito    69 PYHAEINFYTNNYLYKRAGALITLNYVITPASSFHHYFIHGDMLYGYITLGSVFNST---TQWEQ 130

  Fly   108 NGNFIKHSSA-------------DIALIRI--PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACG 157
            ..|:.:.|..             :||:||:  |.:. ...|..:.||..:|. ..|......:||
Mosquito   131 TINYTESSIVMHPFFHYTNEDYYNIAIIRLDRPAIQ-TRYVKPIRLPKLSDT-RTYLAMEGTSCG 193

  Fly   158 W----GGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTH 218
            .    |.:|..:||.....|       ..:.:.|  :..|...|.....|.|.|....|..|...
Mosquito   194 TTKEEGLSYLRNPLLSLSIC-------RQQLTSY--TFHDQHYCTDVYRGGSFCNRQCGSSLTVE 249

  Fly   219 D--GTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |  |..|:||.:.  :..|....|..:.|::...:||:
Mosquito   250 DENGPVLIGVVDL--LFQCSYSYPVRYVRLSAFREWIQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/259 (20%)
Tryp_SPc 40..256 CDD:238113 55/261 (21%)
AgaP_AGAP005594XP_315604.2 Tryp_SPc 60..285 CDD:304450 53/240 (22%)
Tryp_SPc 60..284 CDD:214473 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.