DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:243 Identity:68/243 - (27%)
Similarity:98/243 - (40%) Gaps:69/243 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 CGGSIIAHDWVLTAEHCIGDADSV---TVYFG------ATWRTNAQFTHWVGNGNFIKHSSADIA 120
            ||||:|....||||.||..:.|.|   .|..|      ..:....||....|..:|.:|      
Mosquito    17 CGGSLITPRHVLTAAHCALNDDGVAPQVVRLGVIDITAGLYDPQNQFAQEYGISSFRRH------ 75

  Fly   121 LIRIPHVDF---WHMVNKVELPSYNDRYNDYNEWWAVACGWGG----------------TYDGSP 166
                |..:|   :|.:..|.|    ||.....:....||.|.|                ::.|..
Mosquito    76 ----PEHEFRAEYHDIGLVTL----DRPVTLTDAVVPACLWTGAQVPLRRLEAVGFGQTSFGGER 132

  Fly   167 LPDYLQCVDLQIIHNSECSGYY--------GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGTKL 223
            .|..|: |.|..:.||.|..:|        |.: |..:|. :.:...||.|||||||    ..||
Mosquito   133 TPILLK-VQLSPVDNSACGRFYPPSRRRRQGLI-DQQMCA-SDERMDTCHGDSGGPL----QLKL 190

  Fly   224 ----------VGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
                      ||:|:||..  |.:..||.:.||:.::||::..||:::
Mosquito   191 MANNRLIPFVVGITSFGRF--CGTATPAVYTRVSSYVDWLQTETGVSF 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/233 (28%)
Tryp_SPc 40..256 CDD:238113 66/236 (28%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 66/234 (28%)
Tryp_SPc 1..227 CDD:214473 64/232 (28%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.