DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005194

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_314093.2 Gene:AgaP_AGAP005194 / 1274900 VectorBaseID:AGAP005194 Length:272 Species:Anopheles gambiae


Alignment Length:247 Identity:76/247 - (30%)
Similarity:99/247 - (40%) Gaps:46/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTH 104
            |.:|..|||..|||.|.|...|...|.|||:...|:||||||:    .:..:|..  |:|.  |.
Mosquito    34 IVDGSDAEENAAPYQVSLQIDGNSTCSGSIVGDRWILTAEHCV----PLLQFFSE--RSNN--TR 90

  Fly   105 WVGNGNFIKHSSA----------------------------DIALIRI-PHVDFWHMVNKVELPS 140
            .|...|.:|....                            ||||||: ..:.|...|.|:|..:
Mosquito    91 VVAGTNDLKKGGTPYFIDRFFNYDNCSTMLVHTFMFNSTPNDIALIRLTTPLKFNQRVKKIEFTT 155

  Fly   141 YNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDG 203
            .....|.    .....|||...:|:. |..||.::...|....|...|..  :.|..:|..:..|
Mosquito   156 ETVPENA----TLTLTGWGQMRNGTS-PAKLQTINAPSIRIDHCRAIYNETYLNDGTICSLSKRG 215

  Fly   204 KSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
            :..|.|||||| ||..| ||||:.......||..|.|.....|.|:..||:|
Mosquito   216 EGACMGDSGGP-VTWKG-KLVGIFKAVHNKGCGEGFPDIHTSVAYYYKWIKD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/243 (30%)
Tryp_SPc 40..256 CDD:238113 76/247 (31%)
AgaP_AGAP005194XP_314093.2 Tryp_SPc 34..266 CDD:238113 76/247 (31%)
Tryp_SPc 34..263 CDD:214473 73/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.