DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:236 Identity:71/236 - (30%)
Similarity:107/236 - (45%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYF----------- 92
            ||..|..||:.:.||.:.|.:.|.:.||||||....||||.||:.|.|.:...|           
Mosquito    28 RIVGGQLAEDTQMPYQIALFYQGSFRCGGSIIGDRHVLTAAHCVMDDDVLLPAFKFGVHAGSAHL 92

  Fly    93 ---GATWRTNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMVNKVEL-----PSYNDRYNDY 148
               |..::..|.:.| .|.||| :|   |||::.:.. ..|...:..:||     |...:     
Mosquito    93 NAGGKLFKVRAVYPH-EGYGNF-QH---DIAVMEMKEPFAFDKYIQPIELMDEEVPLGGE----- 147

  Fly   149 NEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGG 213
                .|..|:|......|:...|....:.::.:..|:    |:.:.::|:........|.|||||
Mosquito   148 ----VVISGYGRVGSNGPVSPALLYTSMFVVEDENCN----SISEGLMCIDKEGSYGACNGDSGG 204

  Fly   214 PLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |.| :|| ||.||.|| .:..|......|:.:|:::|||||
Mosquito   205 PAV-YDG-KLAGVANF-IIDQCGGNFADGYAKVSFYLDWIR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/233 (29%)
Tryp_SPc 40..256 CDD:238113 70/235 (30%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 68/233 (29%)
Tryp_SPc 29..243 CDD:238113 70/235 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.