DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:264 Identity:75/264 - (28%)
Similarity:111/264 - (42%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQG------------------RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVL 76
            ||...|..|                  ||..|.|.|:....:...|.:...:.||||:::..:|:
Mosquito    83 PVFASDSSGPSQNCTPCKCGSVEPINERIVGGIPVEDNSFSWMAALYYDNKFCCGGSLLSDRYVI 147

  Fly    77 TAEHCIGDADS--VTVYFGATWR-----TNAQ------FTHWVGNGNFIKHSSADIALIRIPH-V 127
            ||.||....|.  ..|.||...|     |:.:      .|:|....|    ::.||||:.:.: |
Mosquito   148 TAAHCTTKPDRGLFRVQFGINDRSKPIATSIERSVKRILTNWYNAFN----NNNDIALLELTYPV 208

  Fly   128 DFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSEC--SGYYG- 189
            .....|..:.||...:.|....   .:..|||.|..|..|...|...::.|:.|.||  :||:. 
Mosquito   209 AISDRVMPICLPQATEMYEGSR---GIVTGWGRTKAGGGLSGTLMQTEVPILTNRECRRAGYWAF 270

  Fly   190 SVGDNILCV-RTPDGKSTCGGDSGGPL----VTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYH 249
            .:.:.:||. ....||.:|.|||||||    ...:..:||||.::|. |..|...|..:.||:.:
Mosquito   271 QITNKMLCAGYLEGGKDSCQGDSGGPLQVLNTKSNHYELVGVVSWGR-ACAQKNFPGVYARVSQY 334

  Fly   250 LDWI 253
            |.||
Mosquito   335 LYWI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/235 (29%)
Tryp_SPc 40..256 CDD:238113 70/236 (30%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 69/235 (29%)
Tryp_SPc 111..341 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.