DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP002432

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312513.5 Gene:AgaP_AGAP002432 / 1273529 VectorBaseID:AGAP002432 Length:318 Species:Anopheles gambiae


Alignment Length:257 Identity:83/257 - (32%)
Similarity:118/257 - (45%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TPVHTKDMQG-RITNGYPAEEGKAPYTVGL--GFSGG-WWCGGSIIAHDWVLTAEHCI---GDAD 86
            ||:.|::... ||.||..|..|:.||.|.|  .|:.| ..||.|||...:||||.||:   .||.
Mosquito    56 TPIATQNAPNRRIVNGQEARPGQFPYQVALLGQFNAGVGLCGASIITQRYVLTAAHCVYTGVDAS 120

  Fly    87 SV----TVYFGA-------------TWRTNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWHMV 133
            :.    |...||             |:.::....|   .|..:.....|||::|:.. :.:...:
Mosquito   121 APVANGTAILGAHNRMIEEPSQQRITFSSSGVIGH---PGYDLFDVRNDIAVVRLDELIVYTDRI 182

  Fly   134 NKVELPSYNDRYNDYNEWWAVACGWGGTYDGSP-LPDYLQCVDLQIIHNSEC----SGYYGSVGD 193
            ..:.|||.:|. ..:........|:|.....:| |.|.|..|...::.|::|    ||....:..
Mosquito   183 QPIRLPSRSDT-RTFAGLMGTVSGYGIYSTANPALSDVLNYVLNPVMTNADCRAGWSGLEWLIEA 246

  Fly   194 NILCVRTPDGKSTCGGDSGGPLVTHD-GTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            ..:|.....|::.|..||||||...| |..| |||.:|||..||.:|.|..|.||||:|:||
Mosquito   247 QNICQSGDGGRAACNSDSGGPLTVQDSGESLQVGVVSFGSSVGCDNGVPTVFARVTYYLEWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 78/244 (32%)
Tryp_SPc 40..256 CDD:238113 79/245 (32%)
AgaP_AGAP002432XP_312513.5 Tryp_SPc 67..308 CDD:214473 78/244 (32%)
Tryp_SPc 68..311 CDD:238113 79/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.