DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:285 Identity:81/285 - (28%)
Similarity:112/285 - (39%) Gaps:93/285 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HTKDMQGRITNGYPAEEGKAPYTVGLGFS-----GG-------WWCGGSIIAHDWVLTAEHCIGD 84
            |...:.|.|..|..|...:.|:...||.|     ||       |:|||::|:..:||||.||...
Mosquito    18 HLITVVGAIVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHCAHT 82

  Fly    85 ADS---VTVYFGATWRTNAQFTH-------WVGNGNFIKH-------SSADIALIRI-------- 124
            ..|   ..|..||         |       :||..:.:.|       :..||||||:        
Mosquito    83 GMSHPPTVVQLGA---------HDLRRPALYVGVRDVVLHPGYGGVLAYNDIALIRLESPVASSI 138

  Fly   125 -PHVDFWHMVNKVE-LPSYNDRYNDYNEWWAVACGWG--GTYDGSPLPDYLQCVDLQIIHNSECS 185
             |.: .|......| :|             .:|.|||  |.::...:  .||.|.:.|:.||:|:
Mosquito   139 QPAL-LWRSETIPENVP-------------LIATGWGKLGHFEDPSM--ILQRVQIPIVPNSQCN 187

  Fly   186 G-YYGS------VGDNILCVRTPD-GKSTCGGDSGGPLVTHDGTKL--------------VGVTN 228
            . .|.|      |..:.||...|: ||.||.|||||||    ..||              ||:|:
Mosquito   188 QLLYRSRRLRHGVLPSQLCAGDPNGGKDTCEGDSGGPL----QLKLPSARPIGQAYRYYVVGITS 248

  Fly   229 FGSVAGCQSGAPAGFQRVTYHLDWI 253
            .|.:.|... .|..:.||:.:..||
Mosquito   249 NGGICGTVD-RPGLYTRVSSYAGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 77/276 (28%)
Tryp_SPc 40..256 CDD:238113 79/277 (29%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 79/277 (29%)
Tryp_SPc 26..272 CDD:214473 77/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.