DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:205 Identity:54/205 - (26%)
Similarity:82/205 - (40%) Gaps:63/205 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 VTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVEL-PSYNDRYNDY--- 148
            :|::.|:|.:|         .|..|..:|                  |:.: |.||...:||   
Mosquito     1 ITLHGGSTTQT---------RGGVIFQAS------------------KIVIHPYYNPETHDYDAA 38

  Fly   149 -------------------------NEWWAVACGWG-GTYDGSPLPDYLQCVDLQIIHNSECSGY 187
                                     ::....|.||| ..||....||.||...||:|...:||..
Mosquito    39 IVEIKTSFQGYDNIAPIALQDAEVPSDTTCYAAGWGLNNYDRRTTPDNLQYATLQVITQQQCSAA 103

  Fly   188 YGSVG-DNILCVRTPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHL- 250
            :||.. ..::|.:..:....|.||||||.|.:.  ||.|.|::|.: ||:...|:.|.:||... 
Mosquito   104 WGSYATPQVICAQQNNNGDVCKGDSGGPFVCNG--KLTGATSYGGI-GCRGRLPSAFAKVTAPAI 165

  Fly   251 -DWIRDHTGI 259
             ::||:..||
Mosquito   166 REFIRNTAGI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 50/197 (25%)
Tryp_SPc 40..256 CDD:238113 52/200 (26%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 52/200 (26%)
Tryp_SPc <1..162 CDD:214473 49/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.