DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:304 Identity:92/304 - (30%)
Similarity:136/304 - (44%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFIAILALAVASASG-----------ATMPR--------LATEKLT-----PVHTKDMQGRITNG 43
            :.:|:.|||.|..:.           ..||:        |..:.||     |...:| ..||.||
Mosquito     4 SLLALFALACAVMAADDIDWSKVRPMTRMPQYWRRLPKDLLKQYLTEVRNMPAGARD-NARIVNG 67

  Fly    44 YPAEEGKAPYTVGL--GF-SGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQ---- 101
            |.|:.|:.||.|.:  .| :|...||||::..::||||.||:..::...|.:||..||..:    
Mosquito    68 YVAQPGQFPYQVAILSTFPTGSGLCGGSVLTANYVLTAAHCVDVSNGGLVIYGAQDRTVNEPSQQ 132

  Fly   102 -----------FTHWVGNGNFIKHSSADIALIR-IPHVDFWHMVNKVELPSYNDRYNDYNEWWAV 154
                       ..:|  |...|::   |||.|| :..|.|...:..|.||..:|..||:......
Mosquito   133 RIAFEQSGVRLHPNW--NPALIRY---DIATIRVVSPVTFSDRIQPVTLPRLSDVGNDFAGLIGT 192

  Fly   155 ACGWGGTYDG-SPLPDYLQCVDLQIIHNSECS-GYYGSVGDNILCVRTPDGKSTCGGDSGGPL-V 216
            ..|:|...|. ......|:.|:..|..|..|| .:.|.|....:|:....|:..|.||||||| :
Mosquito   193 VSGFGRFSDSIQEASAILRYVNNPIQTNLACSVRFPGVVQPENICLSGDSGRGACQGDSGGPLTI 257

  Fly   217 THDGTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTGI 259
            ..|||.: :||.:||...||:...|:.|.|.|..|.||.:::.:
Mosquito   258 VRDGTTVQLGVVSFGLALGCELNWPSVFARTTSFLAWIGENSDV 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 78/236 (33%)
Tryp_SPc 40..256 CDD:238113 79/238 (33%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 78/236 (33%)
Tryp_SPc 64..295 CDD:238113 77/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25803
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.