DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP007251

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_308541.4 Gene:AgaP_AGAP007251 / 1269887 VectorBaseID:AGAP007251 Length:313 Species:Anopheles gambiae


Alignment Length:307 Identity:92/307 - (29%)
Similarity:134/307 - (43%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGA------TMPRLATEKLTPV---------------------HTKDMQG 38
            |:..|.:|.::|:.|.||      |:..:...::.||                     |.....|
Mosquito     1 MRRLIVLLLVSVSIAHGAAYSVPSTVDSIDWTRVKPVEELDHYWARLPPELQAYRNGTHGTHPSG 65

  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWW---CGGSIIAHDWVLTAEHCIGDADSVT------VYFGA 94
            |||||..|..|:.||...|....|.:   |||:::..:::|||.||: ..|..|      ...||
Mosquito    66 RITNGLEARVGQFPYQALLLTEFGMFTIMCGGTVLTPNFILTAAHCV-MLDQTTKATGGMAILGA 129

  Fly    95 TWRTNAQFTHW---VGNGNFIKHSS-------ADIALIRI-PHVDFWHMVNKVELPSYNDRYNDY 148
            ..|...:.|..   ......|.|.|       .|:|::|: ..:.|...|..|.||:..|: ..:
Mosquito   130 HNRMVVESTQQRIRFATSGIIVHPSYTATNFRFDVAMVRLNAPLRFNSYVQPVRLPARTDQ-RLF 193

  Fly   149 NEWWAVACGWGGTYD-GSPLPDYLQCVDLQIIHNSECSGYYGS--VGDNILCVRTPDGKSTCGGD 210
            :.......|:|.|.| ...||..|:.....|:.|..|:..:||  |..:.:|:....|:|.|.||
Mosquito   194 DGIIGTVSGFGRTNDKDGILPSILRYTINTILSNGACAARWGSLLVEPHNICLSGDGGRSACVGD 258

  Fly   211 SGGPLVTHDG---TKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIR 254
            |||||...:.   |..||||:|||..||..|.|..:.||:|.||||:
Mosquito   259 SGGPLTIEEWGGITYQVGVTSFGSGNGCTDGMPTVYGRVSYFLDWIK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 78/239 (33%)
Tryp_SPc 40..256 CDD:238113 79/241 (33%)
AgaP_AGAP007251XP_308541.4 Tryp_SPc 66..304 CDD:214473 78/239 (33%)
Tryp_SPc 67..307 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.