DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP012736

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_307014.4 Gene:AgaP_AGAP012736 / 1268455 VectorBaseID:AGAP012736 Length:340 Species:Anopheles gambiae


Alignment Length:179 Identity:55/179 - (30%)
Similarity:87/179 - (48%) Gaps:26/179 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FTHWVG-NGNF--IKHSSA---------------DIALIRI-PHVDFWHMVNKVELPSYNDRYND 147
            :.:||. |.:|  |:.:|.               |:|||.: ..:.|...|..:.||:..|. ..
Mosquito   162 YLNWVEINSDFQRIRFTSTGIRRHPEYDDTSLRNDVALILLNSPMTFTSRVKPISLPARTDT-RQ 225

  Fly   148 YNEWWAVACGWGGTYDGSPLP-DYLQCVDLQIIHNSECS---GYYGSVGDNILCVRTPDGKSTCG 208
            :..:.....|:|.:.|.||.| ..|:.....|:..:||.   |:..:...|: |::...|:|:|.
Mosquito   226 FEGFTGTVSGFGRSSDASPYPSSILRFTSNPIMSKAECIVSWGFALAQSQNV-CLKPTGGRSSCN 289

  Fly   209 GDSGGPLVTHDGTKL-VGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
            |||||||..:.|..| :|..:|||..||.||.|:.:.||:|.|.||.::
Mosquito   290 GDSGGPLTVNSGGVLQIGTVSFGSSYGCASGWPSMYARVSYFLSWINEN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 53/174 (30%)
Tryp_SPc 40..256 CDD:238113 55/177 (31%)
AgaP_AGAP012736XP_307014.4 Tryp_SPc <7..167 CDD:238113 1/4 (25%)
Tryp_SPc <7..166 CDD:214473 0/3 (0%)
Tryp_SPc <168..335 CDD:214473 51/168 (30%)
Tryp_SPc <169..338 CDD:238113 53/170 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.