DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Gzmbl3

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001316809.1 Gene:Gzmbl3 / 120766154 RGDID:2320502 Length:248 Species:Rattus norvegicus


Alignment Length:279 Identity:80/279 - (28%)
Similarity:113/279 - (40%) Gaps:60/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF----SG 61
            ||..:.:|.:::|..:.|                   |.|..|:.|:....||...|..    ||
  Rat     1 MKVLLLLLTVSLAPTTEA-------------------GEIIGGHEAKPHSRPYMAYLQIMDEDSG 46

  Fly    62 GWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGA-TWRTNAQFTHWVGNGNFIKHS-------SAD 118
            ...|||.:|..|:||||.||:|  ..:||..|| ..:...:....:.....|.|.       |.|
  Rat    47 STMCGGFLIQEDFVLTAAHCLG--SKITVTLGAHNIKEQEKMQQVIPVVKIIPHPAYNSKKYSND 109

  Fly   119 IALIRI-PHVDFWHMVNKVELPSYN------DRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDL 176
            |.|::: ........|..:.||..|      |..|        ..|||........||.||.|:|
  Rat   110 IMLLKLKSKAKRTRAVKTLSLPRSNFKVKPGDVCN--------VAGWGKLGPMGKFPDKLQEVEL 166

  Fly   177 QIIHNSECSGYYGSVGD--NILCVRTPDGK-STCGGDSGGPLVTHDGTKLV--GVTNFGSVAGCQ 236
            .:..:.||..|:....:  |.:|...|..| ::.|||||||||    .|.|  |:..:||..|  
  Rat   167 TVQEDQECETYFKKAYNKANQICAGDPKIKRASFGGDSGGPLV----CKKVAAGIVAYGSKNG-- 225

  Fly   237 SGAPAGFQRVTYHLDWIRD 255
             .||..|.:|:..|.||::
  Rat   226 -SAPEAFTKVSTFLSWIKE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/237 (30%)
Tryp_SPc 40..256 CDD:238113 74/240 (31%)
Gzmbl3NP_001316809.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.