DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Ctrl

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:288 Identity:85/288 - (29%)
Similarity:134/288 - (46%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGW-WCGGS 68
            :.:..:.:.|:.|..:|     .:||..:.:.  ||.||..|..|..|:.|.|..:.|: :||||
  Rat     6 LTLSLVLLGSSWGCGVP-----AITPALSYNQ--RIVNGENAVPGSWPWQVSLQDNTGFHFCGGS 63

  Fly    69 IIAHDWVLTAEHC----------IGDADSVTVYFGATWRTNAQ----------FTHWVGNGNFIK 113
            :||.:||:||.||          :|:.|.         .:||:          .||...|.|.:.
  Rat    64 LIAPNWVVTAAHCKVTPGRHFVILGEYDR---------SSNAEPIQVLSISKAITHPSWNPNTMN 119

  Fly   114 HSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVAC---GWG---GTYDGSPLPDYL 171
            :   |:.|:::.. ..:...|:.|.|.|.|:....     .:.|   |||   |.  |:..|..|
  Rat   120 N---DLTLLKLASPARYTAQVSPVCLASSNEALPA-----GLTCVTTGWGRISGV--GNVTPARL 174

  Fly   172 QCVDLQIIHNSECSGYYGS-VGDNILCVRTPDGKSTCGGDSGGPLVTHDGTK--LVGVTNFGSVA 233
            |.|.|.::..::|..|:|| :.|:::|.... |.|:|.||||||||...|..  |:|:.::|: .
  Rat   175 QQVVLPLVTVNQCRQYWGSRITDSMICAGGA-GASSCQGDSGGPLVCQKGNTWVLIGIVSWGT-E 237

  Fly   234 GCQSGAPAGFQRVTYHLDWIRDHTGIAY 261
            .|...|||.:.||:....||  :..|||
  Rat   238 NCNVQAPAMYTRVSKFNTWI--NQVIAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 75/244 (31%)
Tryp_SPc 40..256 CDD:238113 76/246 (31%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 75/244 (31%)
Tryp_SPc 34..260 CDD:238113 76/248 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.