DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC116411715

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:274 Identity:70/274 - (25%)
Similarity:106/274 - (38%) Gaps:77/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PVHTKDMQGRITNGYPAEEGKAPYTVGL----GFSGGWWCGGSIIAHDWVLTAEHCI------GD 84
            |:..|.  .||..|..:..||.|:.|.:    |......||||::...|||||.||.      .:
 Frog    34 PLFNKG--SRIVGGQNSPPGKWPWMVSIQSPTGKEFSHLCGGSVLNEIWVLTAAHCFKHLQRKEE 96

  Fly    85 ADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYN--DRYND 147
            ..|..:.|||               |.:|...:.:.:.:|..|        ::..:||  ...||
 Frog    97 TKSWRLVFGA---------------NNLKVLESSVQIRKIKEV--------IQPKAYNPTTEAND 138

  Fly   148 -----------YNEWWAVAC-----------------GWGGTYDGSPLP-DYLQCVDLQIIHNSE 183
                       :.::...||                 |||...:.|..| :.||...:..|.:.:
 Frog   139 ITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDCYIAGWGVLDEESGEPSEILQEARVHQIDSKK 203

  Fly   184 CSG---YYGSVGDNILCV-RTPDGKSTCGGDSGGPLVTHDGTK----LVGVTNFGSVAGCQSG-A 239
            |:.   |.|::|:..||. ....|..:|.|||||||:......    :||:|::||  ||..| .
 Frog   204 CNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPLMCKTQKSRTYAVVGITSWGS--GCARGKK 266

  Fly   240 PAGFQRVTYHLDWI 253
            |..:....|.:.||
 Frog   267 PGVYTSTKYFIKWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 66/263 (25%)
Tryp_SPc 40..256 CDD:238113 67/264 (25%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.