DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and KLK8

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_653088.1 Gene:KLK8 / 11202 HGNCID:6369 Length:305 Species:Homo sapiens


Alignment Length:240 Identity:67/240 - (27%)
Similarity:107/240 - (44%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 HTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATW 96
            |::..:.::..|:..:....|:...|.......|||.::..:|||||.||  .....||..|...
Human    70 HSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHC--KKPKYTVRLGDHS 132

  Fly    97 RTN-----------AQFTHWVGNGNFIKHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNE 150
            ..|           ....|...|.:.::..:.|:.|:::.  |...:.:||:..|..|......:
Human   133 LQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLR--DQASLGSKVKPISLADHCTQPGQ 195

  Fly   151 WWAVACGWGG-TYDGSPLPDYLQCVDLQIIHNSEC-SGYYGSVGDNILCVRTPDGKSTCGGDSGG 213
            ...|: |||. |......||.|.|.:::|....:| ..|.|.:.|.::|..:..|..||.|||||
Human   196 KCTVS-GWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGG 259

  Fly   214 PLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDHTG 258
            |||. ||. |.|:|::||....:|..|..:..:..:||||:...|
Human   260 PLVC-DGA-LQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 63/226 (28%)
Tryp_SPc 40..256 CDD:238113 65/228 (29%)
KLK8NP_653088.1 Tryp_SPc 77..297 CDD:214473 63/226 (28%)
Tryp_SPc 78..300 CDD:238113 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.