DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:241 Identity:78/241 - (32%)
Similarity:111/241 - (46%) Gaps:49/241 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GYPAEEGK-APYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFG---ATWRTNAQFT 103
            |||.|:|. .||:    ||    ||||:|:..::|||.||....|.|.|..|   .|..:..|..
Mosquito    90 GYPREDGSPEPYS----FS----CGGSLISDRFILTAAHCFSYGDPVIVRLGEYDLTVDSTTQLD 146

  Fly   104 HWVGNGNFIKH-------SSADIALIRIPH-VDFWHMVNKVEL---PSYN-DRYNDYNEWWAVAC 156
              .|....|:|       |..|:||:|:.. |.|..::....|   |:.| .|:        ||.
Mosquito   147 --FGIAEIIRHPKYRNSRSYHDLALVRLNETVLFSKVIRPACLWTNPTLNVSRF--------VAT 201

  Fly   157 GWGGTYDGS-PLPDYLQCVDLQIIHNSECSGYY-------GSVGDNILCVRT-PDGKSTCGGDSG 212
            |:|...:|| .|...|..|.|.:..:|:|...:       ..:.:..|||.: ..||.||.||||
Mosquito   202 GFGKQEEGSTDLSTKLMKVQLDLFPSSDCGELFRDNRKFRDGIDEGQLCVGSLIGGKDTCQGDSG 266

  Fly   213 GPLVTHDGTK-----LVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            |||.|....:     :||||:.|:..|. ..:.|.:.:|.::||||
Mosquito   267 GPLQTITEPRSCIYNIVGVTSTGAACGV-GNSKAIYSKVAHYLDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 76/239 (32%)
Tryp_SPc 40..256 CDD:238113 78/241 (32%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 78/241 (32%)
Tryp_SPc 72..311 CDD:214473 76/239 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.