DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CLIPB9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_003436374.1 Gene:CLIPB9 / 11175774 VectorBaseID:AGAP013442 Length:401 Species:Anopheles gambiae


Alignment Length:295 Identity:74/295 - (25%)
Similarity:116/295 - (39%) Gaps:59/295 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AVASASGATMPRLATEKLTPVHTKDMQG-----RITNGYPAEEGKAPYTVGLGFSG-----GWWC 65
            |.|.:..|.:.......|.|...|:..|     ||..|..|:..:.|:...|.:..     .:.|
Mosquito   114 ATAPSGDAALADQLVGGLLPNPKKNECGVSIGMRIYGGQNADIDEFPWLALLQYENRKGERKYSC 178

  Fly    66 GGSIIAHDWVLTAEHC-IGDADS-----VTVYFGATWRTNAQFTHW--------------VGNGN 110
            |||:|...:||||.|| ||:.:.     |:|..| .:.|..:....              .|..:
Mosquito   179 GGSLINRRYVLTAAHCVIGEVERKEGKLVSVRLG-EYNTKTEIDCVTEEQEEICADPPIDAGIES 242

  Fly   111 FIKH-------SSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYD---- 163
            .|.|       .:.||||:|:.. :::...|..|.||..:.|.:...|...|. |:|.|..    
Mosquito   243 VIVHPGYQDMAHADDIALLRLAQSIEYTSFVQPVCLPLTDFRASKTGEVNFVT-GFGRTLQESRS 306

  Fly   164 ------GSPLPDYLQCVDLQIIHNSECSGYYGSVGDNILCVRTPDGKSTCGGDSGGPLVTHDGT- 221
                  |..:.|:.:|.:.....||       |:..|.||......|.:|.|||||||:..... 
Mosquito   307 AVKQKLGIKVYDHARCQEKYATKNS-------SITTNQLCAGGEYAKDSCHGDSGGPLMKLQKVW 364

  Fly   222 KLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRDH 256
            .|.|:.::|:..|.:.. |..:..|..::.|:|.:
Mosquito   365 YLEGIVSYGNRCGLEDW-PGVYTHVPAYMAWVRSN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 65/257 (25%)
Tryp_SPc 40..256 CDD:238113 66/259 (25%)
CLIPB9XP_003436374.1 CLIP 31..85 CDD:288855
Tryp_SPc 147..395 CDD:214473 65/257 (25%)
Tryp_SPc 148..398 CDD:238113 66/259 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.