DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and KLK11

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011524671.1 Gene:KLK11 / 11012 HGNCID:6359 Length:307 Species:Homo sapiens


Alignment Length:305 Identity:76/305 - (24%)
Similarity:114/305 - (37%) Gaps:94/305 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            :.:||||.....|.|                   ||..|:..:....|:...|.......||.::
Human    38 LILLALATGLVGGET-------------------RIIKGFECKPHSQPWQAALFEKTRLLCGATL 83

  Fly    70 IAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTH--------------------WVGNGNFIKH 114
            ||..|:|||.||:           ..|.:....||                    .:|..|..|.
Human    84 IAPRWLLTAAHCL-----------KPWVSLTSPTHVSPDLSSSNYCLSHLSRYIVHLGQHNLQKE 137

  Fly   115 SSAD---IALIRIPHVDFWHMVNKVELPSYNDRYND---------YNEWWAV------------- 154
            ...:   .|....||..|     ...||: .|..||         .:..|||             
Human   138 EGCEQTRTATESFPHPGF-----NNSLPN-KDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAG 196

  Fly   155 -AC---GWGGTYDGSP---LPDYLQCVDLQIIHNSEC-SGYYGSVGDNILCVRTPD-GKSTCGGD 210
             :|   |||.|  .||   ||..|:|.::.||.:.:| :.|.|::.|.::|....: ||.:|.||
Human   197 TSCLISGWGST--SSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGD 259

  Fly   211 SGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWIRD 255
            ||||||.:.  .|.|:.::|......:..|..:.:|..::|||::
Human   260 SGGPLVCNQ--SLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQE 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/267 (25%)
Tryp_SPc 40..256 CDD:238113 69/270 (26%)
KLK11XP_011524671.1 Tryp_SPc 53..300 CDD:214473 68/267 (25%)
Tryp_SPc 54..303 CDD:238113 69/270 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.