DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Cela1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:293 Identity:80/293 - (27%)
Similarity:113/293 - (38%) Gaps:70/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFS-GGWW 64
            |..|:...:|.:...|...:|             :...|:..|..|.....|..:.|.:. ||.|
Mouse     1 MLRFLVFASLVLCGHSTEDVP-------------ETDARVVGGAEARRNSWPSQISLQYQYGGSW 52

  Fly    65 ---CGGSIIAHDWVLTAEHCIGDADSVTVY------------FGATWRTNAQ--FTHWVGNGNFI 112
               |||::|..:||:||.||:   ||...|            .|.....|.|  .:|...|.|.:
Mouse    53 HHTCGGTLIRSNWVMTAAHCV---DSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNV 114

  Fly   113 KHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDY--------------NEWWAVACGWGGTYD 163
            . :..||||:|        :...|.|       |:|              |.......|||.|..
Mouse   115 V-AGYDIALLR--------LAKSVTL-------NNYVQLGVLPREGTILANNSPCYITGWGRTRT 163

  Fly   164 GSPLPDYLQCVDLQIIHNSEC--SGYYGSVGDNILCVRTPDG-KSTCGGDSGGPL--VTHDGTKL 223
            ...|...||...|..:..|.|  |.|:||...|.:.....|| :|.|.|||||||  :.:....:
Mouse   164 NGELAQTLQQAYLPSVSYSICSSSSYWGSSVKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAV 228

  Fly   224 VGVTNFGSVAGCQ-SGAPAGFQRVTYHLDWIRD 255
            .|||:|.|..||. :..|..|.||:.::.|:.:
Mouse   229 HGVTSFVSSMGCNVARKPTVFTRVSAYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 74/251 (29%)
Tryp_SPc 40..256 CDD:238113 74/254 (29%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 74/250 (30%)
Tryp_SPc 27..262 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.