DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and PRSS21

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:282 Identity:79/282 - (28%)
Similarity:124/282 - (43%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILALAVASASGATMP--RLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWCGGSI 69
            :|||.:|.| |...|  :.|.....|...:.:..||..|..||.|:.|:...|.......||.|:
Human     8 LLALLLARA-GLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSL 71

  Fly    70 IAHDWVLTAEHC------IGDADSVTVYFG------ATWRTNAQFT-HWVGN----GNFIKHSSA 117
            ::|.|.|||.||      :.|.....|.||      :.|...|.:| ::|.|    ..::.:|..
Human    72 LSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPY 136

  Fly   118 DIALIRI-PHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTY----DGSPLPDYLQCVDLQ 177
            ||||::: ..|.:...:..:.|.:....:.:..:.|..  |||  |    :..|.|..||.|.:.
Human   137 DIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVT--GWG--YIKEDEALPSPHTLQEVQVA 197

  Fly   178 IIHNSECSGYY-------GSVGDNILCVRTPDGKSTCGGDSGGPLVTHDG--TKLVGVTNFGSVA 233
            ||:||.|:..:       ...||.:.......||..|.|||||||..:..  ...:||.::|  .
Human   198 IINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWG--V 260

  Fly   234 GC-QSGAPAGFQRVTYHLDWIR 254
            || :...|..:..:::|.:||:
Human   261 GCGRPNRPGVYTNISHHFEWIQ 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/245 (28%)
Tryp_SPc 40..256 CDD:238113 69/247 (28%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.