DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:260 Identity:79/260 - (30%)
Similarity:119/260 - (45%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PRLATEKLTPVHTKDMQGRITNGYPAEEGKA----PYTVGLGFSGGWWCGGSIIAHDWVLTAEHC 81
            |..|...:.||::       :||....:..:    |:...|.:..|..||||:|..:|||:|.||
Zfish   292 PSAAVCGIIPVNS-------SNGTVGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHC 349

  Fly    82 IGDADS---VTVYFGATWR-----------TNAQFTHWVGNGNFIKHSSADIALIRIPH-VDFWH 131
            .....:   :||..|...:           ..|...|...|.|   .:..||||:|:.. :.|..
Zfish   350 FNGQRNGFYLTVILGPKTQNKYDPSRISRSVKAVIKHPYYNPN---TNDNDIALVRLSFPITFTD 411

  Fly   132 MVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD--YLQCVDLQIIHNSECSGYY--GSVG 192
            .:..|.|.:....:|...|.|...  |....||.|||.  ..|.|::.:|.|.:|:..|  ||:.
Zfish   412 SIRPVCLAAEGSVFNSDTESWITT--WRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSIT 474

  Fly   193 DNILCV-RTPDGKSTCGGDSGGPLVTHDGTKLV--GVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            ||::|. ...:||..|.||||||:|::..:..|  |:.:|||  || ||..|..:.||:.:.:||
Zfish   475 DNMICAGLLKEGKDLCQGDSGGPMVSNQSSVWVQSGIVSFGS--GCAQSEFPGVYTRVSRYQEWI 537

  Fly   254  253
            Zfish   538  537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/240 (30%)
Tryp_SPc 40..256 CDD:238113 75/241 (31%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 71/234 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.