DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC103908930

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001373362.1 Gene:LOC103908930 / 103908930 -ID:- Length:243 Species:Danio rerio


Alignment Length:238 Identity:75/238 - (31%)
Similarity:109/238 - (45%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGYPAEEGKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFT 103
            :|..||.......|:.:.:...|..|||.|:|...|.::|.||...|:.:|||.|         .
Zfish    20 KIIGGYECPPNSQPWQIYITNDGQRWCGASLINESWAVSAAHCNIGANLLTVYLG---------K 75

  Fly   104 HWVGNGNFIKHSSADIALIRI-PHVDFWH-------MVNKVELPSYNDRYNDYNE--WWAVAC-- 156
            |   |.:.::.:...|...:: ||.:|..       |:.|::.|:.   :|.|.:  ..|.:|  
Zfish    76 H---NIDVVEKTEQRIRTEKVFPHPEFKFPSEDNDIMLIKLKDPAV---FNQYVQPIPLATSCSS 134

  Fly   157 --------GWGGTYDGSPLPDYLQCVDLQIIHNSECSGYY-GSVGDNILCVRTPD-GKSTCGGDS 211
                    |||.|..|  ||..|||:||.:....||...| .....|:||....: ||..|.|||
Zfish   135 EGEQCLVSGWGYTEVG--LPSVLQCLDLAVQSRQECERVYKDKFTQNMLCAGFMEGGKGVCHGDS 197

  Fly   212 GGPLVTHDGTKLVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            |||||.:.  :|.||.::|  ||| :.|.||.:..|..:.|||
Zfish   198 GGPLVCNG--ELRGVVSWG--AGCAEPGYPAVYVEVCRYSDWI 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 73/236 (31%)
Tryp_SPc 40..256 CDD:238113 75/237 (32%)
LOC103908930NP_001373362.1 Tryp_SPc 21..239 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.