DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Klk15

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038952112.1 Gene:Klk15 / 102553035 RGDID:1310995 Length:169 Species:Rattus norvegicus


Alignment Length:262 Identity:60/262 - (22%)
Similarity:88/262 - (33%) Gaps:107/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWWC 65
            |...:|.:.|..|:..|..:  |..|:..| |::                 |:.|.|...|.:.|
  Rat     1 MWLLLAFILLVSAAQDGDKV--LEGEECVP-HSQ-----------------PWQVALFERGRFNC 45

  Fly    66 GGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFIKHSSADIALIRIPHVDFW 130
            |..:|:..|||||.||                 ..:|.                           
  Rat    46 GAFLISPHWVLTAAHC-----------------QTRFM--------------------------- 66

  Fly   131 HMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSGYYGSV-GDN 194
                :|.|..:|.|                .:||   |:.|:.|...|.|    .||.... ..:
  Rat    67 ----RVRLGEHNLR----------------KFDG---PEQLRSVSRIIPH----PGYEARTHRHD 104

  Fly   195 ILCVR-------TPDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDW 252
            |:.:|       ||.      ||||||||.  |..|.|:.::|.|....:..|..:.:|..::||
  Rat   105 IMLLRLFRPARLTPQ------GDSGGPLVC--GGALQGIVSWGDVPCDTTTKPGVYTKVCSYMDW 161

  Fly   253 IR 254
            ||
  Rat   162 IR 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 48/221 (22%)
Tryp_SPc 40..256 CDD:238113 51/223 (23%)
Klk15XP_038952112.1 Tryp_SPc 23..165 CDD:238113 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.