Sequence 1: | NP_648217.1 | Gene: | Jon66Cii / 38953 | FlyBaseID: | FBgn0035887 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188994.1 | Gene: | CG42694 / 10178792 | FlyBaseID: | FBgn0261584 | Length: | 512 | Species: | Drosophila melanogaster |
Alignment Length: | 249 | Identity: | 50/249 - (20%) |
---|---|---|---|
Similarity: | 80/249 - (32%) | Gaps: | 97/249 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 62 GW----------WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFI---- 112
Fly 113 --KHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVD 175
Fly 176 L--------QIIHNSECSGYY------------------------GSVGDNILCVRTPDGKSTCG 208
Fly 209 GDSGG----PLVTHDGTKLVGVTNFGSVAGCQSG-----APAGFQRVTYHLDWI 253 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Jon66Cii | NP_648217.1 | Tryp_SPc | 39..253 | CDD:214473 | 48/247 (19%) |
Tryp_SPc | 40..256 | CDD:238113 | 50/249 (20%) | ||
CG42694 | NP_001188994.1 | Tryp_SPc | 46..256 | CDD:304450 | 49/248 (20%) |
Tryp_SPc | 46..253 | CDD:214473 | 47/246 (19%) | ||
Tryp_SPc | 319..505 | CDD:304450 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45435751 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |