DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CG42694

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:249 Identity:50/249 - (20%)
Similarity:80/249 - (32%) Gaps:97/249 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GW----------WCGGSIIAHDWVLTAEHCIGDADSVTVYFGATWRTNAQFTHWVGNGNFI---- 112
            ||          .|.||:|:..:||:|..||.....:.|..|.:..|.:  .||....|.:    
  Fly    45 GWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATKS--PHWYTVSNVVIPSH 107

  Fly   113 --KHSSADIALIRIPHVDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYLQCVD 175
              |....||.|:::               |.:..|||:                    .|..|:.
  Fly   108 SGKRLQRDIGLLKL---------------SQSVDYNDF--------------------VYPICIA 137

  Fly   176 L--------QIIHNSECSGYY------------------------GSVGDNILCVRTPDGKSTCG 208
            |        :|:.|...|.:.                        |:|....:|..:....::|.
  Fly   138 LNTNTLDMVKILQNFTTSAWLSKNKNPQTIVLSQLSRDRCKLNLSGNVTPKEICAASLQRNNSCF 202

  Fly   209 GDSGG----PLVTHDGTKLVGVTNFGSVAGCQSG-----APAGFQRVTYHLDWI 253
            .|||.    |::  .|:.:|....|| :.|..:|     .||.:..|...:.||
  Fly   203 IDSGSALTQPII--QGSNIVREMLFG-IRGYVNGRSWCSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 48/247 (19%)
Tryp_SPc 40..256 CDD:238113 50/249 (20%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 49/248 (20%)
Tryp_SPc 46..253 CDD:214473 47/246 (19%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.