DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and tmprss2.15

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:246 Identity:74/246 - (30%)
Similarity:112/246 - (45%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGG---WWCGGSIIAHDWVLTAEHCI-GD----------AD 86
            :..||..|.||..|..|:.|.|....|   :.||||||...|::||.||: |.          |.
 Frog   261 VDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIVTAAHCVYGSTSTPSAFKVFAG 325

  Fly    87 SVTV--YFGATWRTNAQFTHWVGNGNFIKHSS----ADIALIRI-PHVDFWHMVNKVELPSYNDR 144
            |:|:  |:.|.:.......|       ..:||    .|:||::: ..:.|...:..|.||:....
 Frog   326 SLTIQSYYSAGYTVERALVH-------PSYSSYTQIYDVALLKLTAALVFTTNLRPVCLPNVGMP 383

  Fly   145 YNDYNEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECSG---YYGSVGDNILCV-RTPDGKS 205
            :.:....|  ..|||.|.:|..:...|....:.||.::.|:.   |.|::...::|. ....|..
 Frog   384 WAEGQPCW--ISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYGGAISSTMMCAGYLSGGTD 446

  Fly   206 TCGGDSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            ||.|||||||||...:.  |||.|::|  .|| ::..|..:..||..::||
 Frog   447 TCQGDSGGPLVTKTNSLWWLVGDTSWG--YGCARAYKPGVYGNVTVFIEWI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 72/241 (30%)
Tryp_SPc 40..256 CDD:238113 73/242 (30%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055
Tryp_SPc 265..498 CDD:238113 73/242 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.