DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and LOC101732176

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:242 Identity:71/242 - (29%)
Similarity:110/242 - (45%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 MQGRITNGYPAEEGKAPYTVGLGFSGG---WWCGGSIIAHDWVLTAEHCIGD-----------AD 86
            :..||..|..|..|..|:.:.|....|   :.||||||...|::||.||:..           |.
 Frog   273 VDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAG 337

  Fly    87 SVTV--YFGATWRTNAQFTHWVGNGNFIKHSSADIALIRI-PHVDFWHMVNKVELPSYNDRYNDY 148
            |:|:  |:.|.:..:....|...:.|   ..:.||||::: ..:.|...:..|.||:....:.|.
 Frog   338 SLTLSNYYSAGYLVDRVLIHPSYSPN---TQNYDIALLKLKTALVFSTNLRPVCLPNVGMPWADG 399

  Fly   149 NEWWAVACGWGGTYDGSPLPDYLQCVDLQIIHNSECS---GYYGSVGDNILCV-RTPDGKSTCGG 209
            ...|  ..|||.|.:...:...|:...:.||.::.|:   .|.|.:...::|. ....|..||.|
 Frog   400 QPCW--ISGWGTTSEAGSISTSLKAASVPIISSATCNLAPVYGGVISPTMICAGYLGGGTDTCQG 462

  Fly   210 DSGGPLVTHDGTK--LVGVTNFGSVAGC-QSGAPAGFQRVTYHLDWI 253
            ||||||||...:.  |||.|::|  .|| ::..|..:..:|..|:||
 Frog   463 DSGGPLVTKTNSLWWLVGDTSWG--YGCARAYKPGVYGNITVFLEWI 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/237 (29%)
Tryp_SPc 40..256 CDD:238113 70/238 (29%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055
Tryp_SPc 277..510 CDD:238113 70/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.