DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Klk9

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_082936.2 Gene:Klk9 / 101533 MGIID:1921082 Length:251 Species:Mus musculus


Alignment Length:253 Identity:71/253 - (28%)
Similarity:100/253 - (39%) Gaps:63/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGYPAEE---GKAPYTVGLGFSGGWWCGGSIIAHDWVLTAEHC--------IGDADSVTVY 91
            |..|....|.|   ...|:..||.:.....||.::|...|:|||.||        :|:..     
Mouse    18 GADTRAVGARECVRNSQPWQAGLFYLTRQLCGATLINDQWLLTAAHCRKPYLWVRLGEHH----- 77

  Fly    92 FGATWRTNAQFTHWVGN------GNFIKH-----------SSADIALIRIPH-VDFWHMVNKVEL 138
               .||       |.|.      .:|..|           .:.||.|||:|. |.....|..:.|
Mouse    78 ---LWR-------WEGPEQLLLVTDFFPHPGFNPDLSANDHNDDIMLIRLPRKVRLTPAVQPLNL 132

  Fly   139 ----PSYNDRYNDYNEWWAVACGWGGTYDGSPL--PDYLQCVDLQIIHNSECS-GYYGSVGDNIL 196
                |....:        .:..|| |:...|.|  |..|||.::.|:.|..|. .|.|.:.:.:|
Mouse   133 TESRPPVGTQ--------CLISGW-GSVSSSKLQYPMTLQCANISILDNKLCRWAYPGHISEKML 188

  Fly   197 CVRT-PDGKSTCGGDSGGPLVTHDGTKLVGVTNFGSVAGCQSGAPAGFQRVTYHLDWI 253
            |... ..|:.:|.||||||||. :|| |.|:.:.||....:...||.:..|..:|:||
Mouse   189 CAGLWEGGRGSCQGDSGGPLVC-EGT-LAGIVSGGSEPCSRPRRPAVYTNVFDYLEWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 68/250 (27%)
Tryp_SPc 40..256 CDD:238113 70/251 (28%)
Klk9NP_082936.2 Tryp_SPc 24..247 CDD:238113 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.