DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and CELA3A

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_005738.4 Gene:CELA3A / 10136 HGNCID:15944 Length:270 Species:Homo sapiens


Alignment Length:288 Identity:90/288 - (31%)
Similarity:122/288 - (42%) Gaps:58/288 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAFIAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGF--SGGW 63
            ::...::|.:||||..|..             :.....|:.:|..|.....|:.|.|.:  ||.:
Human     3 LRLLSSLLLVAVASGYGPP-------------SSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSF 54

  Fly    64 W--CGGSIIAHDWVLTAEHCIGDADSVTVYFG-------------ATWRTNAQFTH--W----VG 107
            :  ||||:||.|||:||.|||....:..|..|             ....:...|.|  |    |.
Human    55 YHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVA 119

  Fly   108 NGNFIKHSSADIALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPDYL 171
            .||       |||||::.. ......|....||...|...  |:......|||..|...||||.|
Human   120 CGN-------DIALIKLSRSAQLGDAVQLASLPPAGDILP--NKTPCYITGWGRLYTNGPLPDKL 175

  Fly   172 QCVDLQIIHNSECS--GYYGS-VGDNILCVRTPDG--KSTCGGDSGGPL--VTHD-GTKLVGVTN 228
            |...|.::....||  .::|| |...::|.   .|  :|.|.|||||||  .|.| |.::.|||:
Human   176 QQARLPVVDYKHCSRWNWWGSTVKKTMVCA---GGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTS 237

  Fly   229 FGSVAGCQ-SGAPAGFQRVTYHLDWIRD 255
            |.|..||. ...|..|.||:..:|||.:
Human   238 FVSAFGCNFIWKPTVFTRVSAFIDWIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 82/246 (33%)
Tryp_SPc 40..256 CDD:238113 83/249 (33%)
CELA3ANP_005738.4 Tryp_SPc 28..263 CDD:214473 82/246 (33%)
Tryp_SPc 29..266 CDD:238113 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.