DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and cela1.2

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:291 Identity:79/291 - (27%)
Similarity:117/291 - (40%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKD--MQGRITNGYPAEEGKAPYTVGLGFSG----GW 63
            :.||.|:|.:......||         :.||  ::.|:..|..|:....|:.:.|.:|.    .:
Zfish     2 LRILLLSVLATLALAEPR---------YLKDIAIEERVVGGEIAKPHSWPWQISLQYSDLGTYYY 57

  Fly    64 WCGGSIIAHDWVLTAEHCI----------GDADSVT------------VYFGATWRTNAQFTHWV 106
            :|.|::|...||:.|.||:          ||.|..|            |:....|..|       
Zfish    58 YCSGTLIRPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNPN------- 115

  Fly   107 GNGNFIKHSSADIALIRIPHVD--FWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDGSPLPD 169
             |..|    ..||||:|: .:|  ....|....||| :.....|.....:. |||.|..|..|..
Zfish   116 -NVAF----GYDIALLRL-SIDATLSSYVQVATLPS-SGEILPYGHTCYIT-GWGYTETGGSLSA 172

  Fly   170 YLQCVDLQIIHNSECS--GYYG-SVGDNILCVRTPDGKSTCGGDSGGPL--------VTHDGTKL 223
            .|:...:.::....||  .::| ||.:.::|.......|.|.||||.||        |.|     
Zfish   173 QLKQAYMPVVDYETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVH----- 232

  Fly   224 VGVTNFGSVAGCQS-GAPAGFQRVTYHLDWI 253
             |||:|.|..||.: ..|.||.||:.:::||
Zfish   233 -GVTSFVSPEGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 69/253 (27%)
Tryp_SPc 40..256 CDD:238113 70/254 (28%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 69/253 (27%)
Tryp_SPc 30..265 CDD:238113 70/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.