DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon66Cii and Tpsab1

DIOPT Version :9

Sequence 1:NP_648217.1 Gene:Jon66Cii / 38953 FlyBaseID:FBgn0035887 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:282 Identity:92/282 - (32%)
Similarity:126/282 - (44%) Gaps:52/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IAILALAVASASGATMPRLATEKLTPVHTKDMQGRITNGYPAEEGKAPYTVGLGFSGGWW---CG 66
            :.:|:..|.:|.|..|.|              :| |..|..|...|.|:.|.|..:..:|   ||
Mouse     9 LPLLSSLVHAAPGPAMTR--------------EG-IVGGQEAHGNKWPWQVSLRANDTYWMHFCG 58

  Fly    67 GSIIAHDWVLTAEHCIG----DADSVTV-------YFGATWRTNAQ-FTHWVGNGNFIKHSSADI 119
            ||:|...|||||.||:|    |.:.|.|       |:.....|.:| .||   ...:|....|||
Mouse    59 GSLIHPQWVLTAAHCVGPDVADPNKVRVQLRKQYLYYHDHLMTVSQIITH---PDFYIVQDGADI 120

  Fly   120 ALIRIPH-VDFWHMVNKVELPSYNDRYNDYNEWWAVACGWGGTYDG--SPLPDYLQCVDLQIIHN 181
            ||:::.: |:....|:.|.||..::.:......|..  |||...:|  .|.|..|:.|.:.||.|
Mouse   121 ALLKLTNPVNISDYVHPVPLPPASETFPSGTLCWVT--GWGNIDNGVNLPPPFPLKEVQVPIIEN 183

  Fly   182 SECSGYYGS---VGDNILCVRTP------DGKSTCGGDSGGPLV--THDGTKLVGVTNFGSVAGC 235
            ..|...|..   .|||:..||..      :|..:|.||||||||  ..|.....||.::|.  ||
Mouse   184 HLCDLKYHKGLITGDNVHIVRDDMLCAGNEGHDSCQGDSGGPLVCKVEDTWLQAGVVSWGE--GC 246

  Fly   236 -QSGAPAGFQRVTYHLDWIRDH 256
             |...|..:.||||:||||..:
Mouse   247 AQPNRPGIYTRVTYYLDWIHHY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon66CiiNP_648217.1 Tryp_SPc 39..253 CDD:214473 83/243 (34%)
Tryp_SPc 40..256 CDD:238113 85/245 (35%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 84/243 (35%)
Tryp_SPc 29..265 CDD:214473 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.